LZTS1 polyclonal antibody (A01)
  • LZTS1 polyclonal antibody (A01)

LZTS1 polyclonal antibody (A01)

Ref: AB-H00011178-A01
LZTS1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LZTS1.
Información adicional
Size 50 uL
Gene Name LZTS1
Gene Alias F37|FEZ1
Gene Description leucine zipper, putative tumor suppressor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LZTS1 (NP_066300, 514 a.a. ~ 596 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11178

Enviar uma mensagem


LZTS1 polyclonal antibody (A01)

LZTS1 polyclonal antibody (A01)