BAZ1A polyclonal antibody (A01)
  • BAZ1A polyclonal antibody (A01)

BAZ1A polyclonal antibody (A01)

Ref: AB-H00011177-A01
BAZ1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BAZ1A.
Información adicional
Size 50 uL
Gene Name BAZ1A
Gene Alias ACF1|DKFZp586E0518|FLJ14383|WALp1|WCRF180|hACF1
Gene Description bromodomain adjacent to zinc finger domain, 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BAZ1A (NP_038476, 1457 a.a. ~ 1556 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11177

Enviar uma mensagem


BAZ1A polyclonal antibody (A01)

BAZ1A polyclonal antibody (A01)