SOX21 monoclonal antibody (M01), clone 2G10
  • SOX21 monoclonal antibody (M01), clone 2G10

SOX21 monoclonal antibody (M01), clone 2G10

Ref: AB-H00011166-M01
SOX21 monoclonal antibody (M01), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOX21.
Información adicional
Size 100 ug
Gene Name SOX21
Gene Alias SOX25
Gene Description SRY (sex determining region Y)-box 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX21 (NP_009015, 224 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11166
Clone Number 2G10
Iso type IgG2a Kappa

Enviar uma mensagem


SOX21 monoclonal antibody (M01), clone 2G10

SOX21 monoclonal antibody (M01), clone 2G10