NUDT5 polyclonal antibody (A01)
  • NUDT5 polyclonal antibody (A01)

NUDT5 polyclonal antibody (A01)

Ref: AB-H00011164-A01
NUDT5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NUDT5.
Información adicional
Size 50 uL
Gene Name NUDT5
Gene Alias YSA1|YSA1H|hYSAH1
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUDT5 (NP_054861, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11164

Enviar uma mensagem


NUDT5 polyclonal antibody (A01)

NUDT5 polyclonal antibody (A01)