NUDT4 MaxPab rabbit polyclonal antibody (D01)
  • NUDT4 MaxPab rabbit polyclonal antibody (D01)

NUDT4 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011163-D01
NUDT4 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NUDT4 protein.
Información adicional
Size 100 uL
Gene Name NUDT4
Gene Alias DIPP2|DIPP2alpha|DIPP2beta|DKFZp686I1281|HDCMB47P|KIAA0487
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUDT4 (NP_061967.3, 1 a.a. ~ 180 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11163

Enviar uma mensagem


NUDT4 MaxPab rabbit polyclonal antibody (D01)

NUDT4 MaxPab rabbit polyclonal antibody (D01)