PTP4A3 polyclonal antibody (A01)
  • PTP4A3 polyclonal antibody (A01)

PTP4A3 polyclonal antibody (A01)

Ref: AB-H00011156-A01
PTP4A3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PTP4A3.
Información adicional
Size 50 uL
Gene Name PTP4A3
Gene Alias PRL-3|PRL-R|PRL3
Gene Description protein tyrosine phosphatase type IVA, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTP4A3 (AAH03105, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11156

Enviar uma mensagem


PTP4A3 polyclonal antibody (A01)

PTP4A3 polyclonal antibody (A01)