CORO1A monoclonal antibody (M01), clone 4G10
  • CORO1A monoclonal antibody (M01), clone 4G10

CORO1A monoclonal antibody (M01), clone 4G10

Ref: AB-H00011151-M01
CORO1A monoclonal antibody (M01), clone 4G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CORO1A.
Información adicional
Size 100 ug
Gene Name CORO1A
Gene Alias CLABP|CLIPINA|FLJ41407|HCORO1|MGC117380|TACO|p57
Gene Description coronin, actin binding protein, 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CORO1A (NP_009005, 360 a.a. ~ 461 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11151
Clone Number 4G10
Iso type IgG2a Kappa

Enviar uma mensagem


CORO1A monoclonal antibody (M01), clone 4G10

CORO1A monoclonal antibody (M01), clone 4G10