CORO1A polyclonal antibody (A01)
  • CORO1A polyclonal antibody (A01)

CORO1A polyclonal antibody (A01)

Ref: AB-H00011151-A01
CORO1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CORO1A.
Información adicional
Size 50 uL
Gene Name CORO1A
Gene Alias CLABP|CLIPINA|FLJ41407|HCORO1|MGC117380|TACO|p57
Gene Description coronin, actin binding protein, 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CORO1A (NP_009005, 360 a.a. ~ 461 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11151

Enviar uma mensagem


CORO1A polyclonal antibody (A01)

CORO1A polyclonal antibody (A01)