BVES polyclonal antibody (A01)
  • BVES polyclonal antibody (A01)

BVES polyclonal antibody (A01)

Ref: AB-H00011149-A01
BVES polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BVES.
Información adicional
Size 50 uL
Gene Name BVES
Gene Alias HBVES|MGC42413|POP1|POPDC1
Gene Description blood vessel epicardial substance
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BVES (NP_009004, 262 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11149

Enviar uma mensagem


BVES polyclonal antibody (A01)

BVES polyclonal antibody (A01)