HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P)
  • HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P)

HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011145-D01P
HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HRASLS3 protein.
Información adicional
Size 100 ug
Gene Name PLA2G16
Gene Alias AdPLA|H-REV107-1|HRASLS3|HREV107|HREV107-3|MGC118754
Gene Description phospholipase A2, group XVI
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HRASLS3 (AAH01387.1, 1 a.a. ~ 162 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11145

Enviar uma mensagem


HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P)

HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P)