PLA2G16 MaxPab rabbit polyclonal antibody (D01)
  • PLA2G16 MaxPab rabbit polyclonal antibody (D01)

PLA2G16 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011145-D01
PLA2G16 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLA2G16 protein.
Información adicional
Size 100 uL
Gene Name PLA2G16
Gene Alias AdPLA|H-REV107-1|HRASLS3|HREV107|HREV107-3|MGC118754
Gene Description phospholipase A2, group XVI
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLA2G16 (AAH01387.1, 1 a.a. ~ 162 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11145

Enviar uma mensagem


PLA2G16 MaxPab rabbit polyclonal antibody (D01)

PLA2G16 MaxPab rabbit polyclonal antibody (D01)