DMC1 polyclonal antibody (A01)
  • DMC1 polyclonal antibody (A01)

DMC1 polyclonal antibody (A01)

Ref: AB-H00011144-A01
DMC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DMC1.
Información adicional
Size 50 uL
Gene Name DMC1
Gene Alias DMC1H|HsLim15|LIM15|MGC150472|MGC150473|dJ199H16.1
Gene Description DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DMC1 (NP_008999, 237 a.a. ~ 339 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11144

Enviar uma mensagem


DMC1 polyclonal antibody (A01)

DMC1 polyclonal antibody (A01)