MYST2 monoclonal antibody (M01), clone 2G5
  • MYST2 monoclonal antibody (M01), clone 2G5

MYST2 monoclonal antibody (M01), clone 2G5

Ref: AB-H00011143-M01
MYST2 monoclonal antibody (M01), clone 2G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYST2.
Información adicional
Size 100 ug
Gene Name MYST2
Gene Alias HBO1|HBOA|KAT7
Gene Description MYST histone acetyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYST2 (AAH32640, 512 a.a. ~ 611 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11143
Clone Number 2G5
Iso type IgG1 kappa

Enviar uma mensagem


MYST2 monoclonal antibody (M01), clone 2G5

MYST2 monoclonal antibody (M01), clone 2G5