TBC1D8 monoclonal antibody (M02), clone 1A12
  • TBC1D8 monoclonal antibody (M02), clone 1A12

TBC1D8 monoclonal antibody (M02), clone 1A12

Ref: AB-H00011138-M02
TBC1D8 monoclonal antibody (M02), clone 1A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TBC1D8.
Información adicional
Size 100 ug
Gene Name TBC1D8
Gene Alias AD3|HBLP1|VRP
Gene Description TBC1 domain family, member 8 (with GRAM domain)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLHAVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIILPLREVVSIEKME
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TBC1D8 (NP_008994, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11138
Clone Number 1A12
Iso type IgG2a Kappa

Enviar uma mensagem


TBC1D8 monoclonal antibody (M02), clone 1A12

TBC1D8 monoclonal antibody (M02), clone 1A12