CDC42EP1 polyclonal antibody (A01)
  • CDC42EP1 polyclonal antibody (A01)

CDC42EP1 polyclonal antibody (A01)

Ref: AB-H00011135-A01
CDC42EP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CDC42EP1.
Información adicional
Size 50 uL
Gene Name CDC42EP1
Gene Alias BORG5|CEP1|MGC15316|MSE55
Gene Description CDC42 effector protein (Rho GTPase binding) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC42EP1 (AAH09356, 1 a.a. ~ 384 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11135

Enviar uma mensagem


CDC42EP1 polyclonal antibody (A01)

CDC42EP1 polyclonal antibody (A01)