KPTN purified MaxPab mouse polyclonal antibody (B01P)
  • KPTN purified MaxPab mouse polyclonal antibody (B01P)

KPTN purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011133-B01P
KPTN purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KPTN protein.
Información adicional
Size 50 ug
Gene Name KPTN
Gene Alias 2E4
Gene Description kaptin (actin binding protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KPTN (NP_008990.2, 1 a.a. ~ 436 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11133

Enviar uma mensagem


KPTN purified MaxPab mouse polyclonal antibody (B01P)

KPTN purified MaxPab mouse polyclonal antibody (B01P)