ZWINT MaxPab rabbit polyclonal antibody (D01)
  • ZWINT MaxPab rabbit polyclonal antibody (D01)

ZWINT MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011130-D01
ZWINT MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZWINT protein.
Información adicional
Size 100 uL
Gene Name ZWINT
Gene Alias HZwint-1|KNTC2AP|MGC117174|ZWINT1
Gene Description ZW10 interactor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDGVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZWINT (AAH20979.1, 1 a.a. ~ 277 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11130

Enviar uma mensagem


ZWINT MaxPab rabbit polyclonal antibody (D01)

ZWINT MaxPab rabbit polyclonal antibody (D01)