CD160 purified MaxPab mouse polyclonal antibody (B01P)
  • CD160 purified MaxPab mouse polyclonal antibody (B01P)

CD160 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011126-B01P
CD160 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CD160 protein.
Información adicional
Size 50 ug
Gene Name CD160
Gene Alias BY55|FLJ46513|NK1|NK28
Gene Description CD160 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD160 (AAH14465.1, 1 a.a. ~ 181 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11126

Enviar uma mensagem


CD160 purified MaxPab mouse polyclonal antibody (B01P)

CD160 purified MaxPab mouse polyclonal antibody (B01P)