FAF1 monoclonal antibody (M01), clone 1A10
  • FAF1 monoclonal antibody (M01), clone 1A10

FAF1 monoclonal antibody (M01), clone 1A10

Ref: AB-H00011124-M01
FAF1 monoclonal antibody (M01), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FAF1.
Información adicional
Size 100 ug
Gene Name FAF1
Gene Alias CGI-03|FLJ37524|HFAF1s|UBXD12|UBXN3A|hFAF1
Gene Description Fas (TNFRSF6) associated factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FAF1 (NP_008982, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11124
Clone Number 1A10
Iso type IgG1 Kappa

Enviar uma mensagem


FAF1 monoclonal antibody (M01), clone 1A10

FAF1 monoclonal antibody (M01), clone 1A10