HIBADH purified MaxPab rabbit polyclonal antibody (D01P)
  • HIBADH purified MaxPab rabbit polyclonal antibody (D01P)

HIBADH purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011112-D01P
HIBADH purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HIBADH protein.
Información adicional
Size 100 ug
Gene Name HIBADH
Gene Alias MGC40361|NS5ATP1
Gene Description 3-hydroxyisobutyrate dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HIBADH (NP_689953.1, 1 a.a. ~ 336 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11112

Enviar uma mensagem


HIBADH purified MaxPab rabbit polyclonal antibody (D01P)

HIBADH purified MaxPab rabbit polyclonal antibody (D01P)