DATF1 polyclonal antibody (A01)
  • DATF1 polyclonal antibody (A01)

DATF1 polyclonal antibody (A01)

Ref: AB-H00011083-A01
DATF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DATF1.
Información adicional
Size 50 uL
Gene Name DIDO1
Gene Alias BYE1|C20orf158|DATF1|DIDO2|DIDO3|DIO-1|DIO1|DKFZp434P1115|FLJ11265|KIAA0333|MGC16140|dJ885L7.8
Gene Description death inducer-obliterator 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DATF1 (AAH14489, 321 a.a. ~ 420 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11083

Enviar uma mensagem


DATF1 polyclonal antibody (A01)

DATF1 polyclonal antibody (A01)