DNAJB4 polyclonal antibody (A01)
  • DNAJB4 polyclonal antibody (A01)

DNAJB4 polyclonal antibody (A01)

Ref: AB-H00011080-A01
DNAJB4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant DNAJB4.
Información adicional
Size 50 uL
Gene Name DNAJB4
Gene Alias DNAJW|DjB4|HLJ1
Gene Description DnaJ (Hsp40) homolog, subfamily B, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNAJB4 (AAH34721, 1 a.a. ~ 337 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11080

Enviar uma mensagem


DNAJB4 polyclonal antibody (A01)

DNAJB4 polyclonal antibody (A01)