HSF2BP monoclonal antibody (M01), clone 1C4
  • HSF2BP monoclonal antibody (M01), clone 1C4

HSF2BP monoclonal antibody (M01), clone 1C4

Ref: AB-H00011077-M01
HSF2BP monoclonal antibody (M01), clone 1C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HSF2BP.
Información adicional
Size 100 ug
Gene Name HSF2BP
Gene Alias -
Gene Description heat shock transcription factor 2 binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,S-ELISA,ELISA
Immunogen Prot. Seq VLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSF2BP (NP_008962.1, 231 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11077
Clone Number 1C4
Iso type IgG2a Kappa

Enviar uma mensagem


HSF2BP monoclonal antibody (M01), clone 1C4

HSF2BP monoclonal antibody (M01), clone 1C4