TPPP purified MaxPab mouse polyclonal antibody (B01P)
  • TPPP purified MaxPab mouse polyclonal antibody (B01P)

TPPP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011076-B01P
TPPP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TPPP protein.
Información adicional
Size 50 ug
Gene Name TPPP
Gene Alias TPPP/p25|TPPP1|p24|p25|p25alpha
Gene Description tubulin polymerization promoting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPPP (NP_008961, 1 a.a. ~ 219 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11076

Enviar uma mensagem


TPPP purified MaxPab mouse polyclonal antibody (B01P)

TPPP purified MaxPab mouse polyclonal antibody (B01P)