STMN2 monoclonal antibody (M02), clone 1C6
  • STMN2 monoclonal antibody (M02), clone 1C6

STMN2 monoclonal antibody (M02), clone 1C6

Ref: AB-H00011075-M02
STMN2 monoclonal antibody (M02), clone 1C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STMN2.
Información adicional
Size 100 ug
Gene Name STMN2
Gene Alias SCG10|SCGN10|SGC10
Gene Description stathmin-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STMN2 (NP_008960, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11075
Clone Number 1C6
Iso type IgG2a Kappa

Enviar uma mensagem


STMN2 monoclonal antibody (M02), clone 1C6

STMN2 monoclonal antibody (M02), clone 1C6