STMN2 monoclonal antibody (M01A), clone 3B12
  • STMN2 monoclonal antibody (M01A), clone 3B12

STMN2 monoclonal antibody (M01A), clone 3B12

Ref: AB-H00011075-M01A
STMN2 monoclonal antibody (M01A), clone 3B12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STMN2.
Información adicional
Size 200 uL
Gene Name STMN2
Gene Alias SCG10|SCGN10|SGC10
Gene Description stathmin-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STMN2 (NP_008960, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 11075
Clone Number 3B12
Iso type IgM Kappa

Enviar uma mensagem


STMN2 monoclonal antibody (M01A), clone 3B12

STMN2 monoclonal antibody (M01A), clone 3B12