TRIM31 monoclonal antibody (M03), clone 2G11
  • TRIM31 monoclonal antibody (M03), clone 2G11

TRIM31 monoclonal antibody (M03), clone 2G11

Ref: AB-H00011074-M03
TRIM31 monoclonal antibody (M03), clone 2G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM31.
Información adicional
Size 100 ug
Gene Name TRIM31
Gene Alias C6orf13|HCG1|HCGI|RNF
Gene Description tripartite motif-containing 31
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM31 (NP_008959, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11074
Clone Number 2G11
Iso type IgG2a Kappa

Enviar uma mensagem


TRIM31 monoclonal antibody (M03), clone 2G11

TRIM31 monoclonal antibody (M03), clone 2G11