TRIM31 MaxPab mouse polyclonal antibody (B01)
  • TRIM31 MaxPab mouse polyclonal antibody (B01)

TRIM31 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00011074-B01
TRIM31 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM31 protein.
Información adicional
Size 50 uL
Gene Name TRIM31
Gene Alias C6orf13|HCG1|HCGI|RNF
Gene Description tripartite motif-containing 31
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM31 (AAH17017, 1 a.a. ~ 425 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11074

Enviar uma mensagem


TRIM31 MaxPab mouse polyclonal antibody (B01)

TRIM31 MaxPab mouse polyclonal antibody (B01)