TOPBP1 monoclonal antibody (M04), clone 6D12
  • TOPBP1 monoclonal antibody (M04), clone 6D12

TOPBP1 monoclonal antibody (M04), clone 6D12

Ref: AB-H00011073-M04
TOPBP1 monoclonal antibody (M04), clone 6D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TOPBP1.
Información adicional
Size 100 ug
Gene Name TOPBP1
Gene Alias TOP2BP1
Gene Description topoisomerase (DNA) II binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEKNKIKRPRVH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOPBP1 (NP_008958, 1327 a.a. ~ 1435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11073
Clone Number 6D12
Iso type IgG2a Kappa

Enviar uma mensagem


TOPBP1 monoclonal antibody (M04), clone 6D12

TOPBP1 monoclonal antibody (M04), clone 6D12