TMEM115 MaxPab mouse polyclonal antibody (B01) View larger

Mouse polyclonal antibody raised against a full-length human TMEM115 protein.

AB-H00011070-B01

New product

TMEM115 MaxPab mouse polyclonal antibody (B01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 uL
Gene Name TMEM115
Gene Alias PL6
Gene Description transmembrane protein 115
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMEM115 (NP_008955.1, 1 a.a. ~ 351 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11070

More info

Mouse polyclonal antibody raised against a full-length human TMEM115 protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human TMEM115 protein.

Mouse polyclonal antibody raised against a full-length human TMEM115 protein.