TMEM115 MaxPab mouse polyclonal antibody (B01)
  • TMEM115 MaxPab mouse polyclonal antibody (B01)

TMEM115 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00011070-B01
TMEM115 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMEM115 protein.
Información adicional
Size 50 uL
Gene Name TMEM115
Gene Alias PL6
Gene Description transmembrane protein 115
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMEM115 (NP_008955.1, 1 a.a. ~ 351 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11070

Enviar uma mensagem


TMEM115 MaxPab mouse polyclonal antibody (B01)

TMEM115 MaxPab mouse polyclonal antibody (B01)