SOX30 monoclonal antibody (M02), clone 6H1
  • SOX30 monoclonal antibody (M02), clone 6H1

SOX30 monoclonal antibody (M02), clone 6H1

Ref: AB-H00011063-M02
SOX30 monoclonal antibody (M02), clone 6H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOX30.
Información adicional
Size 100 ug
Gene Name SOX30
Gene Alias -
Gene Description SRY (sex determining region Y)-box 30
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq SMPECLSYYEDRYPKHEGIFSTLNRDYSFRDYSSECTHSENSRSCENMNGTSYYNSHSHSGEENLNPVPQLDIGTLENVFTAPTSTPSSIQQVNVTDSDEEEEEKVLRDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX30 (NP_848511, 644 a.a. ~ 753 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11063
Clone Number 6H1
Iso type IgG2a Kappa

Enviar uma mensagem


SOX30 monoclonal antibody (M02), clone 6H1

SOX30 monoclonal antibody (M02), clone 6H1