WWP2 MaxPab rabbit polyclonal antibody (D01)
  • WWP2 MaxPab rabbit polyclonal antibody (D01)

WWP2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011060-D01
WWP2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human WWP2 protein.
Información adicional
Size 100 uL
Gene Name WWP2
Gene Alias AIP2|WWp2-like
Gene Description WW domain containing E3 ubiquitin protein ligase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WWP2 (NP_955455.1, 1 a.a. ~ 335 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11060

Enviar uma mensagem


WWP2 MaxPab rabbit polyclonal antibody (D01)

WWP2 MaxPab rabbit polyclonal antibody (D01)