Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
WWP1 monoclonal antibody (M01), clone 1A7
Abnova
WWP1 monoclonal antibody (M01), clone 1A7
Ref: AB-H00011059-M01
WWP1 monoclonal antibody (M01), clone 1A7
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant WWP1.
Información adicional
Size
100 ug
Gene Name
WWP1
Gene Alias
AIP5|DKFZp434D2111|Tiul1|hSDRP1
Gene Description
WW domain containing E3 ubiquitin protein ligase 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq
CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
11059
Clone Number
1A7
Iso type
IgG2a Kappa
Enviar uma mensagem
WWP1 monoclonal antibody (M01), clone 1A7
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*