NUDT21 monoclonal antibody (M01), clone 2G4-6F11
  • NUDT21 monoclonal antibody (M01), clone 2G4-6F11

NUDT21 monoclonal antibody (M01), clone 2G4-6F11

Ref: AB-H00011051-M01C
NUDT21 monoclonal antibody (M01), clone 2G4-6F11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant NUDT21.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name NUDT21
Gene Alias CFIM25|CPSF5|DKFZp686H1588
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 11051
Clone Number 2G4-6F11
Iso type IgG1 Kappa

Enviar uma mensagem


NUDT21 monoclonal antibody (M01), clone 2G4-6F11

NUDT21 monoclonal antibody (M01), clone 2G4-6F11