SLC35D2 monoclonal antibody (M03), clone 1H5
  • SLC35D2 monoclonal antibody (M03), clone 1H5

SLC35D2 monoclonal antibody (M03), clone 1H5

Ref: AB-H00011046-M03
SLC35D2 monoclonal antibody (M03), clone 1H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC35D2.
Información adicional
Size 100 ug
Gene Name SLC35D2
Gene Alias HFRC1|MGC117215|MGC142139|SQV7L|UGTrel8|hfrc
Gene Description solute carrier family 35, member D2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC35D2 (NP_008932, 74 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11046
Clone Number 1H5
Iso type IgG2a Lambda

Enviar uma mensagem


SLC35D2 monoclonal antibody (M03), clone 1H5

SLC35D2 monoclonal antibody (M03), clone 1H5