POLS monoclonal antibody (M01), clone 2F8
  • POLS monoclonal antibody (M01), clone 2F8

POLS monoclonal antibody (M01), clone 2F8

Ref: AB-H00011044-M01
POLS monoclonal antibody (M01), clone 2F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POLS.
Información adicional
Size 100 ug
Gene Name POLS
Gene Alias LAK-1|POLK|TRF4|TRF4-1
Gene Description polymerase (DNA directed) sigma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLS (NP_008930, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11044
Clone Number 2F8
Iso type IgG2b Kappa

Enviar uma mensagem


POLS monoclonal antibody (M01), clone 2F8

POLS monoclonal antibody (M01), clone 2F8