SMA4 purified MaxPab mouse polyclonal antibody (B01P)
  • SMA4 purified MaxPab mouse polyclonal antibody (B01P)

SMA4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011039-B01P
SMA4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SMA4 protein.
Información adicional
Size 50 ug
Gene Name SMA4
Gene Alias FLJ36702|MGC22265|MGC60382|SMA3|b55C20.2
Gene Description glucuronidase, beta pseudogene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMA4 (NP_067684.2, 1 a.a. ~ 140 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11039

Enviar uma mensagem


SMA4 purified MaxPab mouse polyclonal antibody (B01P)

SMA4 purified MaxPab mouse polyclonal antibody (B01P)