DSTN polyclonal antibody (A01)
  • DSTN polyclonal antibody (A01)

DSTN polyclonal antibody (A01)

Ref: AB-H00011034-A01
DSTN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DSTN.
Información adicional
Size 50 uL
Gene Name DSTN
Gene Alias ACTDP|ADF|bA462D18.2
Gene Description destrin (actin depolymerizing factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DSTN (NP_006861, 56 a.a. ~ 164 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11034

Enviar uma mensagem


DSTN polyclonal antibody (A01)

DSTN polyclonal antibody (A01)