VAX1 monoclonal antibody (M03), clone 2F4
  • VAX1 monoclonal antibody (M03), clone 2F4

VAX1 monoclonal antibody (M03), clone 2F4

Ref: AB-H00011023-M03
VAX1 monoclonal antibody (M03), clone 2F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VAX1.
Información adicional
Size 100 ug
Gene Name VAX1
Gene Alias MGC126743|MGC126745
Gene Description ventral anterior homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VAX1 (NP_954582.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11023
Clone Number 2F4
Iso type IgG2a Kappa

Enviar uma mensagem


VAX1 monoclonal antibody (M03), clone 2F4

VAX1 monoclonal antibody (M03), clone 2F4