IL24 monoclonal antibody (M01), clone 4B6
  • IL24 monoclonal antibody (M01), clone 4B6

IL24 monoclonal antibody (M01), clone 4B6

Ref: AB-H00011009-M01
IL24 monoclonal antibody (M01), clone 4B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL24.
Información adicional
Size 100 ug
Gene Name IL24
Gene Alias C49A|FISP|IL-24|IL10B|MDA7|Mob-5|ST16|mda-7
Gene Description interleukin 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA
Immunogen Prot. Seq GPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL24 (AAH09681, 58 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11009
Clone Number 4B6
Iso type IgG2b Kappa

Enviar uma mensagem


IL24 monoclonal antibody (M01), clone 4B6

IL24 monoclonal antibody (M01), clone 4B6