SLC27A4 monoclonal antibody (M01), clone 1F4-1B10
  • SLC27A4 monoclonal antibody (M01), clone 1F4-1B10

SLC27A4 monoclonal antibody (M01), clone 1F4-1B10

Ref: AB-H00010999-M01
SLC27A4 monoclonal antibody (M01), clone 1F4-1B10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SLC27A4.
Información adicional
Size 100 ug
Gene Name SLC27A4
Gene Alias ACSVL4|FATP4
Gene Description solute carrier family 27 (fatty acid transporter), member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC27A4 (AAH09959.1, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10999
Clone Number 1F4-1B10
Iso type IgG1 kappa

Enviar uma mensagem


SLC27A4 monoclonal antibody (M01), clone 1F4-1B10

SLC27A4 monoclonal antibody (M01), clone 1F4-1B10