SDS monoclonal antibody (M03), clone 1A9
  • SDS monoclonal antibody (M03), clone 1A9

SDS monoclonal antibody (M03), clone 1A9

Ref: AB-H00010993-M03
SDS monoclonal antibody (M03), clone 1A9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SDS.
Información adicional
Size 100 ug
Gene Name SDS
Gene Alias SDH
Gene Description serine dehydratase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SDS (AAH20750, 1 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10993
Clone Number 1A9
Iso type IgG2b Kappa

Enviar uma mensagem


SDS monoclonal antibody (M03), clone 1A9

SDS monoclonal antibody (M03), clone 1A9