SF3B2 purified MaxPab mouse polyclonal antibody (B02P) View larger

Mouse polyclonal antibody raised against a full-length human SF3B2 protein.

AB-H00010992-B02P

New product

SF3B2 purified MaxPab mouse polyclonal antibody (B02P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name SF3B2
Gene Alias SAP145|SF3B145|SF3b1|SF3b150
Gene Description splicing factor 3b, subunit 2, 145kDa
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SF3B2 (AAH07610.1, 1 a.a. ~ 636 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10992

More info

Mouse polyclonal antibody raised against a full-length human SF3B2 protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human SF3B2 protein.

Mouse polyclonal antibody raised against a full-length human SF3B2 protein.