IMMT monoclonal antibody (M01), clone 1A8
  • IMMT monoclonal antibody (M01), clone 1A8

IMMT monoclonal antibody (M01), clone 1A8

Ref: AB-H00010989-M01
IMMT monoclonal antibody (M01), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IMMT.
Información adicional
Size 100 ug
Gene Name IMMT
Gene Alias DKFZp779P1653|HMP|MGC111146|P87|P87/89|P89|PIG4|PIG52
Gene Description inner membrane protein, mitochondrial (mitofilin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IMMT (NP_006830, 481 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10989
Clone Number 1A8
Iso type IgG2a Kappa

Enviar uma mensagem


IMMT monoclonal antibody (M01), clone 1A8

IMMT monoclonal antibody (M01), clone 1A8