IMMT polyclonal antibody (A01)
  • IMMT polyclonal antibody (A01)

IMMT polyclonal antibody (A01)

Ref: AB-H00010989-A01
IMMT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IMMT.
Información adicional
Size 50 uL
Gene Name IMMT
Gene Alias DKFZp779P1653|HMP|MGC111146|P87|P87/89|P89|PIG4|PIG52
Gene Description inner membrane protein, mitochondrial (mitofilin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IMMT (NP_006830, 481 a.a. ~ 580 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10989

Enviar uma mensagem


IMMT polyclonal antibody (A01)

IMMT polyclonal antibody (A01)