MAPRE2 monoclonal antibody (M03), clone 4D7
  • MAPRE2 monoclonal antibody (M03), clone 4D7

MAPRE2 monoclonal antibody (M03), clone 4D7

Ref: AB-H00010982-M03
MAPRE2 monoclonal antibody (M03), clone 4D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPRE2.
Información adicional
Size 100 ug
Gene Name MAPRE2
Gene Alias EB1|EB2|RP1
Gene Description microtubule-associated protein, RP/EB family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPRE2 (NP_055083, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10982
Clone Number 4D7
Iso type IgG1 Kappa

Enviar uma mensagem


MAPRE2 monoclonal antibody (M03), clone 4D7

MAPRE2 monoclonal antibody (M03), clone 4D7