STIP1 polyclonal antibody (A01)
  • STIP1 polyclonal antibody (A01)

STIP1 polyclonal antibody (A01)

Ref: AB-H00010963-A01
STIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant STIP1.
Información adicional
Size 50 uL
Gene Name STIP1
Gene Alias HOP|IEF-SSP-3521|P60|STI1|STI1L
Gene Description stress-induced-phosphoprotein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STIP1 (AAH02987.1, 1 a.a. ~ 543 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10963

Enviar uma mensagem


STIP1 polyclonal antibody (A01)

STIP1 polyclonal antibody (A01)