PDIA5 monoclonal antibody (M01), clone 3A3
  • PDIA5 monoclonal antibody (M01), clone 3A3

PDIA5 monoclonal antibody (M01), clone 3A3

Ref: AB-H00010954-M01
PDIA5 monoclonal antibody (M01), clone 3A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDIA5.
Información adicional
Size 100 ug
Gene Name PDIA5
Gene Alias FLJ30401|PDIR
Gene Description protein disulfide isomerase family A, member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq ERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDIA5 (NP_006801, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10954
Clone Number 3A3
Iso type IgG1 Kappa

Enviar uma mensagem


PDIA5 monoclonal antibody (M01), clone 3A3

PDIA5 monoclonal antibody (M01), clone 3A3