TOMM34 purified MaxPab mouse polyclonal antibody (B01P)
  • TOMM34 purified MaxPab mouse polyclonal antibody (B01P)

TOMM34 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010953-B01P
TOMM34 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TOMM34 protein.
Información adicional
Size 50 ug
Gene Name TOMM34
Gene Alias HTOM34P|TOM34|URCC3
Gene Description translocase of outer mitochondrial membrane 34
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TOMM34 (NP_006800.2, 1 a.a. ~ 309 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10953

Enviar uma mensagem


TOMM34 purified MaxPab mouse polyclonal antibody (B01P)

TOMM34 purified MaxPab mouse polyclonal antibody (B01P)