RALBP1 polyclonal antibody (A01)
  • RALBP1 polyclonal antibody (A01)

RALBP1 polyclonal antibody (A01)

Ref: AB-H00010928-A01
RALBP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RALBP1.
Información adicional
Size 50 uL
Gene Name RALBP1
Gene Alias RIP1|RLIP1|RLIP76
Gene Description ralA binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RALBP1 (AAH13126.1, 1 a.a. ~ 655 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10928

Enviar uma mensagem


RALBP1 polyclonal antibody (A01)

RALBP1 polyclonal antibody (A01)